Adrenomedullin (1-50), rat

Product Number: 335-75

$444.00$716.00

$444.00
$716.00
SKU: 335-75 Category: Tags: ,

CAS Number: 159964-38-2
Molecular Weight: 5727.72
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 [Cys14-Cys19]
Sequence (1-letter): YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2
Storage: -20 °C or below

Adrenomedullin (ADM) is a peptide hormone isolated in 1993 from a pheochromocytoma, a tumor of the adrenal medulla. ADM has roles in tumor progression, regulating endometrial angiogenesis, hypertension, and cardiovascualar disease.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Cardiovascular, Neuropeptides & Hormones

You may also like…

Shopping Cart
Scroll to Top