Adrenomedullin (1-50), rat

Product Number: 335-75

$489
$790

CAS Number: 159964-38-2
Molecular Weight: 5727.72
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 [Cys14-Cys19]
Sequence (1-letter): YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2
Storage: -20 °C or below

Adrenomedullin (ADM) is a peptide hormone isolated in 1993 from a pheochromocytoma, a tumor of the adrenal medulla. ADM has roles in tumor progression, regulating endometrial angiogenesis, hypertension, and cardiovascualar disease.

Categories

Peptides

Filter

Cardiovascular, Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

You may also like…

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders