Adrenomedullin (1-50), rat

CAS Number: 159964-38-2 Molecular Weight: 5727. [Read More...]

Description
Additional Information

CAS Number: 159964-38-2
Molecular Weight: 5727.72
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 [Cys14-Cys19]
Sequence (1-letter): YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2
Storage: -20 °C or below

Adrenomedullin (ADM) is a peptide hormone isolated in 1993 from a pheochromocytoma, a tumor of the adrenal medulla. ADM has roles in tumor progression, regulating endometrial angiogenesis, hypertension, and cardiovascualar disease.

Categories	Peptides
Filter	Cardiovascular, Neuropeptides & Hormones
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

0.3

/ 0.3

0.5 mg (335-75) quantity	0.5 mg (335-75)	$489
1 mg (335-75) quantity	1 mg (335-75)	$790

Adrenomedullin (1-50), rat

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Adrenomedullin (1-50), rat

Related Products

Syntide 2, CaMKII Substrate

Renin Substrate I

Angiotensin II-[Sar1]

Angiotensin I [Asn1,Val5], goosefish

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register