CAS Number: 150138-78-6
Molecular Weight: 4008.98
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
Sequence (1-letter): SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Storage: -20 °C or below
Neuropeptide Y (NPY) is a 36-aa neuropeptide that acts as a neurotransmitter in the brain and in the autonomic nervous system of humans. It binds to a family of g-protein coupled receptors, Y1-Y6, to regulate a variety of functions including feeding behavior and pain perception. Neuropeptide Y (3-36) binds selectively to Y1 and Y5.

