Molecular Weight: 4830.57
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Tyr-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
Sequence (1-letter): YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Storage: -20 °C or below
Corticotropin releasing factor (CRF) is a peptide hormone involved in the stress response that stimulates pituitary synthesis of ACTH, as part of the HPA Axis. CRF [Tyr0] has an N-terminal Tyr added which can be radiolabeled with I-125.

![352-37 Corticotropin Releasing Factor (CRF) [Tyr0], ovine - Echelon Biosciences](https://www.echelon-inc.com/wp-content/uploads/2019/11/352-37.jpg)