Prodynorphin 228-256 (porcine) (Dynorphin B 29, Leumorphin)

Product Number: 274-56

$150.00$230.00

$150.00
$230.00
SKU: 274-56 Category: Tag:

Molecular Weight: 3525.73
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Tyr-Glu-Glu-Leu-Phe-Asp-Val-OH
Sequence (1-letter): YGGFLRRQFKVVTRSQEDPNAYYEELFDV-OH
Storage: -20 °C or below

Leumorphin, porcine which corresponds to the 228-256 fragment of Preproenkephalin B. It is also known as Dynorphin B29 and Prodynorphin 228-256. Leumorphin is potent and selective κ-opioid receptor agonist. The porcine form of Leumorphin differs by 3 amino acids from the human form.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Neuropeptides & Hormones

Shopping Cart
Scroll to Top