PHI, rat

Product Number: 495-25

$204$279

$204
$279
SKU: 495-25 Category: Tag:

CAS Number: 96849-38-6
Molecular Weight: 3009.6
Salt Form: TFA
Purity: >96%
Sequence (3-letter): His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Tyr-Ser-Arg-Leu-Leu-Gly-Gln-Ile-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-NH2
Sequence (1-letter): HADGVFTSDYSRLLGQISAKKYLESLI-NH2
Storage: -20 °C or below

PHI, aka Intestinal peptide PHI-27, is a member of the vasoactive intestinal peptide (VIP) family of peptides. It is has been shown to regulate feeding behavior and prolactin secretion.

Categories

Peptides

Filter

Gastrointestinal

Shopping Cart
Scroll to Top