Parathyroid Hormone (PTH) (4-34), human

Product Number: 231-48

$214
$324

Molecular Weight: 3842.03
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Sequence (1-letter): EIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH
Storage: -20 °C or below

Parathyroid Hormone (4-34) is a N-terminal truncated form of the full length Parathyroid Hormone (PTH). PTH regulates serum calcium levels through its effects in the kidney, intestines, and bones. When serum calcium levels are low, PTH is secreted by the chief cells of the parathyroid gland, stimulating osteoclast activity and bone resorption thus the release of calcium.

Categories

Peptides

Filter

Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders