Galanin, rat

Product Number: 475-25

$179.00$1,053.00

$179.00
$266.00
$1,053.00

CAS Number: 114547-31-8
Molecular Weight: 3162.6
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2
Sequence (1-letter): GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
Storage: -20 °C or below

Galanin is a non-selective agonist that binds the GAL1, GAL2, and GAL3 receptors and inhibits cAMP production. It has been shown to be an anticonvulsant in rats that prevents fully kindled seizures.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Metabolic / Diabetes, Neuropeptides & Hormones

Shopping Cart
Scroll to Top