Galanin, rat

Product Number: 475-25

$197
$293
$1,161

CAS Number: 114547-31-8
Molecular Weight: 3162.6
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2
Sequence (1-letter): GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
Storage: -20 °C or below

Galanin is a non-selective agonist that binds the GAL1, GAL2, and GAL3 receptors and inhibits cAMP production. It has been shown to be an anticonvulsant in rats that prevents fully kindled seizures.

Categories

Peptides

Filter

Metabolic / Diabetes, Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders