Galanin Message Associated Peptide (GMAP) (1-41), amide

Product Number: 421-35

$279.00$437.00

$279.00
$437.00
SKU: 421-35 Category: Tag:

CAS Number: 132699-74-2
Molecular Weight: 4640.38
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Glu-Leu-Glu-Pro-Glu-Asp-Glu-Ala-Arg-Pro-Gly-Gly-Phe-Asp-Arg-Leu-Gln-Ser-Glu-Asp-Lys-Ala-Ile-Arg-Thr-Ile-Met-Glu-Phe-Leu-Ala-Phe-Leu-His-Leu-Lys-Glu-Ala-Gly-Ala-Leu-NH2
Sequence (1-letter): ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGAL-NH2
Storage: -20 °C or below

Galanin Message Associated Peptide (GMAP) is part of the pre-progalanin Galanin (ppGAL) molecule which is a precursor to the neuropeptide galanin. No physiological role for GMAP was known but recent research suggest it has a role in the innate immune system.

 

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Neuropeptides & Hormones

Shopping Cart
Scroll to Top