Galanin, human

Product Number: 471-22

$309$466

$309
$466

CAS Number: 119418-04-1
Molecular Weight: 3155.57
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH
Sequence (1-letter): GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS-OH
Storage: -20 °C or below

Galanin is an endogenous peptide that has been shown to have an action on intestinal smooth muscle, insulin and somatostatin release, and synaptic neurotransmission.

 

Categories

Peptides

Filter

Metabolic / Diabetes, Neuropeptides & Hormones

Shopping Cart
Scroll to Top