Galanin, human

Product Number: 471-22

$309.00$466.00

$309.00
$466.00

CAS Number: 119418-04-1
Molecular Weight: 3155.57
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH
Sequence (1-letter): GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS-OH
Storage: -20 °C or below

Galanin is an endogenous peptide that has been shown to have an action on intestinal smooth muscle, insulin and somatostatin release, and synaptic neurotransmission.

 

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Metabolic / Diabetes, Neuropeptides & Hormones

Shopping Cart
Scroll to Top