Decorsin, Leech (Macrobdella decora)

Product Number: 459-10

$587.00$865.00

$587.00
$865.00
SKU: 459-10 Category: Tag:

Molecular Weight: 4380.85
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala-Asp-Pro-Tyr-Cys-Glu-OH (Cys-7-Cys15, Cys17-Cys27, Cys22-Cys38)
Sequence (1-letter): APRLPQCQGDDQEKCLCNKDECPPGQCRFPRGDADPYCE-OH
Storage: -20 °C or below

Decorsin is a peptide isolated from the North American leech Macrobdella decora. It is a potent inhibitor of platelet aggregation by acting as an antagonist of platelet glycoprotein IIb-IIIa (GPIIb-IIIa) (IC50 = 1.5 nM).

Seymour JL, Henzel WJ, Nevins B, Stults JT, Lazarus RA. Decorsin. A potent glycoprotein IIb-IIIa antagonist and platelet aggregation inhibitor from the leech Macrobdella decora. J Biol Chem. 1990 Jun 15;265(17):10143-7. PMID: 2351655.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Inhibitor

Shopping Cart
Scroll to Top