Corticotropin Releasing Factor (CRF) human, rat

Product Number: 351-25

$254
$419

CAS Number: 86784-80-7
Molecular Weight: 4757.52
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
Sequence (1-letter): SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Storage: -20 °C or below

Corticotropin releasing factor (CRF) is a peptide hormone involved in the stress response that stimulates pituitary synthesis of ACTH, as part of the HPA Axis.

Categories

Peptides

Filter

Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders