Calmodulin Kinase II Inhibitor (281-309)

Product Number: 893-40

$237.00

$237.00
SKU: 893-40 Category: Tags: , , ,

CAS Number: 116826-37-0
Molecular Weight: 3371.86
Salt Form: Acetate
Purity: >96%
Sequence (3-letter): Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OH
Sequence (1-letter): MHRQETVDCLKKFNARRKLKGAILTTMLA-OH
Storage: -20 °C or below

Calmodulin Kinase II Inhibitor (281-309) [CaMKII(281-309)] is a peptide fragment containing the calmodulin binding site (290-309) and the phosphorylation site (Thr286). CaMKII(281-309). It is useful as a calmodulin binding peptide and can act as an inhibitor of CaM kinase II (IC50 = 80 nM) by blocking Ca2+/calmodulin activation and enzyme active site. Alternative name: Calmodulin Dependent Protein Kinase II (281-309)

References

Waxham MN, Aronowski J (1993) “Ca2+/calmodulin-dependent protein kinase II is phosphorylated by protein kinase C in vitro”. Biochemistry 32(11):2923-30

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Kinase

Shopping Cart
Scroll to Top