Calcitonin Gene Related Peptide II (8-37), human / Beta CGRP

Product Number: 231-22

$179.00$266.00

$179.00
$266.00
SKU: 231-22 Category: Tag:

CAS Number: 119911-68-1
Molecular Weight: 3128.71
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2
Sequence (1-letter): VTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2
Storage: -20 °C or below

Calcitonin Gene Related Peptide (CGRP) (8-37) acts as an antagonist against CGRP receptors but not calcitonin receptors.
Calcitonin Gene Related Peptide (CGRP) is produced in central and peripheral neurons and binds to the herterodimeric CGRP receptors found throughout the body. It has roles in modulating the autonomic nervous system, appetite suppression, gastric acid release, temperature homeostasis, and heart rate. CGRP exists in two forms CGRP I (CGRP-α) and CGRP II (CGRP-β)

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Calcitonin Gene Peptides

Shopping Cart
Scroll to Top