Big Endothelin (1-38), human

Product Number: 331-30

$395
$655

CAS Number: 121014-53-7
Molecular Weight: 4283.98
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Arg-Ser-OH [Cys1-Cys15, Cys3-Cys11]
Sequence (1-letter): CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH
Storage: -20 °C or below

Big Endothelin (1-38) is the precursor to the vasoconstricting peptide endothelin-1. It is cleaved by endothelin-converting enzyme (ECE).

Categories

Peptides

Filter

Cardiovascular, Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders