Beta Amyloid [Glu11] (1-38), human

Product Number: 641-25

$214
$326
$1,295
$2,408

CAS Number: 131438-74-9
Molecular Weight: 4129.04
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-OH
Sequence (1-letter): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG-OH
Storage: -20 °C or below

Categories

Peptides

Filter

Alzheimer's, Central Nervous System

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders