Beta Amyloid [Gln 22] (1-42), human

Product Number: 642-30

$338.00$3,788.00

$338.00
$466.00
$1,977.00
$3,788.00
SKU: 642-30 Category: Tags: ,

Molecular Weight: 4510.32
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Sequence (1-letter): DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA-OH
Storage: -20 °C or below

Beta Amyloid [Gln 22] (1-42) contains the E22Q mutation, a point mutation that substitutes glutamine for glutamic acid at position 22, also known as the “Dutch” mutant. The E22Q mutation leads to increased deposition rates of the AβE22Q peptide onto preseeded fibrils and is associated with greater toxicity.

We are in the process of migrating our technical data sheets (TDS) to this space. They can currently be found in the description section of the product pages. Thank you for your patience. For any technical questions, please contact us at echelon@echelon-inc.com

 

Categories

Peptides

Filter

Alzheimer's, Central Nervous System

Shopping Cart
Scroll to Top