Beta Amyloid [Gln 22] (1-42), human

Product Number: 642-30

$355
$489
$2,076
$3,977

Molecular Weight: 4510.32
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Sequence (1-letter): DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA-OH
Storage: -20 °C or below

Beta Amyloid [Gln 22] (1-42) contains the E22Q mutation, a point mutation that substitutes glutamine for glutamic acid at position 22, also known as the “Dutch” mutant. The E22Q mutation leads to increased deposition rates of the AβE22Q peptide onto preseeded fibrils and is associated with greater toxicity.

Categories

Peptides

Filter

Alzheimer's, Central Nervous System

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders