Beta Amyloid (42-1) reverse, human

Product Number: 641-69

$435
$625

CAS Number: 317366-82-8
Molecular Weight: 4514.12
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH
Sequence (1-letter): AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD-OH
Storage: -20 °C or below

Beta amyloid (42-1) is the reverse of beta amyloid (1-42) and is used as an inactive control peptide for beta amyloid (1-42).

Categories

Peptides

Filter

Alzheimer's, Central Nervous System

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders