Beta Amyloid (40-1), reverse, human

Product Number: 641-70

$131
$221

CAS Number: 144409-99-4
Molecular Weight: 4327.18
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH
Sequence (1-letter): VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD-OH
Storage: -20 °C or below

Beta Amyloid (40-1) is an inactive control peptide for Beta Amyloid (1-40). The synthetic sequence is derived from the human Beta Amyloid (1-40).

 

Categories

Peptides

Filter

Alzheimer's, Central Nervous System

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders