Beta Amyloid (40-1), reverse, human

CAS Number: 144409-99-4 Molecular Weight: 4327. [Read More...]

Description
Additional Information

CAS Number: 144409-99-4
Molecular Weight: 4327.18
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH
Sequence (1-letter): VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD-OH
Storage: -20 °C or below

Beta Amyloid (40-1) is an inactive control peptide for Beta Amyloid (1-40). The synthetic sequence is derived from the human Beta Amyloid (1-40).

Categories	Peptides
Filter	Alzheimer's, Central Nervous System
Shipping Temp	Ambient Temperature
Storage	-20 °C or below

/ 0.3

0.5 mg (641-70) quantity	0.5 mg (641-70)	$131
1 mg (641-70) quantity	1 mg (641-70)	$221

Beta Amyloid (40-1), reverse, human

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Beta Amyloid (40-1), reverse, human

Related Products

Angiotensin (1-7)

Urodilatin

Angiotensin II-[Sar1]

Angiotensin I (human)

Get in Touch

If you have any questions or would like to learn more about our services, feel free to reach out to us. We’re here to help!

Login

Register