Beta Amyloid (1-40), human [Gly22] (Arctic mutation)

Product Number: 641-14

$226
$406

CAS Number: 175010-18-1
Molecular Weight: 4255.16
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Sequence (1-letter): DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV-OH
Storage: -20 °C or below

Beta Amyloid (1-40), human [Gly22] (Arctic mutation) causes early onset of Alzheimer′s compared to wild type and promotes protofibril formation and neurotoxicity. Beta amyloid (1-40), along with beta amyloid (1-42) (catalog # 641-15) is one of the two main variants of the amyloid β peptide involved in Alzheimer’s disease. Beta amyloid (1-40) is a peptide that is found in plaques in the brains of patients with Alzheimer’s disease and is shown to have both neurotrophic and neurotoxic effects in human and rat cell culture models.

Categories

Peptides

Filter

Alzheimer's, Central Nervous System

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders