Adrenomedullin (1-52), human

Product Number: 331-80

$489
$790

CAS Number: 148498-78-6
Molecular Weight: 6026.97
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 [Cys16-Cys21]
Sequence (1-letter): YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Storage: -20 °C or below

Adrenomedullin (ADM) is a peptide hormone isolated in 1993 from a pheochromocytoma, a tumor of the adrenal medulla. ADM has roles in tumor progreession, regulating endometrial angiogenesis, hypertension, and cardiovascualr disease.

Categories

Peptides

Filter

Neuropeptides & Hormones

Shipping Temp

Ambient Temperature

Storage

-20 °C or below

Shopping Cart
Scroll to Top

Technical Support

Bulk & Custom Orders