CAS Number: 223460-79-5
Molecular Weight: 3763.82
Salt Form: TFA
Purity: >96%
Sequence (3-letter): His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Sequence (1-letter): HADGSFSDEMNTILDNLAARDFINWLIQTKITD-OH
Storage: -20 °C or below
Glucagon-like Peptide-2 (GLP-2) is a 33-amino acid peptide formed through post-translational proteolytic cleavage of proglucagon. GLP-2 produces a number of effects when administered to humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. An analog of GLP-2, Teduglutide (cat# 471-21) is used to treat short-bowel syndrome.
Publication

